Technical datasheet
Description
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a.
Recombinant human C5a is His-Tagged and has the following amino acid sequence:
M
RGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Formulation
Lyophilized product in PBS containing 50 µg human C5a. Reconstitute the vial by injection of 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Species
Human, E.Coli-derived
Use
For dilutions use protein stabilized phosphate buffered saline, pH 7.4.
Storage and stability
Lyophilized product should be stored at 4°C. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity. Under recommended storage conditions, product is stable for one year.
Precautions
For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and Federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result with the use of or derivation of this product.
Also available
|
HC1101
|
C5a, Mouse, Recombinant
|
|
HC1102
|
C5a des Arg, Mouse, Recombinant
|
|
HC1103
|
C5L2, Mouse, Peptide
|
|
HC2102
|
C5a des Arg, Human, Recombinant
|
|
HC2103
|
C5L2, Human, Peptide
|