0 items | $0.00

CRAMP, Mouse, Peptide

Catalog #: HC1106

Quantity: 50 µg

Availability: In stock

Description: CRAMP, Mouse, Peptide

Cathelicidins are a familiy of antimicrobial proteins predominantly found in the peroxidase-negative granules of neutrophils. the cathelicidins are synthesized as preproteins. Within the neutrophils, they are stored in granules as inactive proforms after removal of the signal peptide. The biologic active domains of the cathelicidins reside in the C-terminus. The C-terminal antimicrobial peptides are activated when cleaved from the proforms of the cathelicidins by serine proteases from azurophilic granules. Cramp (Cathelin-Related Anti-Microbial Peptide) is the mouse analogue of human LL-37 peptide, which is the antibacterial C-terminus of hCAP-18 (human cathelicidin). CRAMP forms an amphipathic α-helix similar to other antimicrobial peptides. Cramp is a potent antibiotic against Gram-negative bacteria by inhibiting growth of a variety of bacterial strains and by permeabilizing the inner membrane of E.coli directly. Abundant expression of Cramp is found in myeloid precursors and neutrophils. Cramp represents the first antibiotic peptide found in cells of myeloid lineage in the mouse. Inflammatory cells in the mouse can thus use a non-oxidative mechanism for microbial killing. The proteins sequence of CRAMP is ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE as compared to [LL-37, 37 aa] for human LL-37.

Specifications

Catalog number HC1106
Product type Proteins
Quantity 50 µg
Species Mouse
Alias Mouse LL-37, Cathelin-Related Antimicrobial Peptide
Formulation Lyophilized product in PBS, containing 50 µg mouse CRAMP. Reconstitute the vial by pipetting distilled or de-ionized water or DMSO (Caution: vial is under vacuum).
Use Dilutions to be used depend on detection system applied. It is recommended that users test the reagent and determine their own optimal dilutions. The typical starting working dilution is 1:50. For functional studies, in vitro dilutions have to be optimized in user’s experimental setting.
Application FS
Storage and stability Lyophilized product should be stored at -20°C. Store stock solution in aliquots at –20°C. Repeated freeze and thaw cycles will cause loss of activity. Lyophilized the product is stable for at least one year, reconstituted and stored at -20°C, the product is stable for 1 month. The exact expiry date is indicated on the label.
Precautions For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result from the use or derivation of this product.
Disease Autoimmunity, Infectious diseases