C5a des Arg, Human, Recombinant

€551.00

Please choose the quantity of items you wish to add to your cart…

Description
Application

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant Human C5a desArg is His-tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQ
RAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG ((His-tag is underlined, bold sequence is tev protease)

Use

For dilutions use protein stabilized phosphate buffered saline, pH 7.4.

Specifications
Downloads

Product type

Proteins

Amount

50 µg

Species

Human

Formulation

Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg human C5a desArg. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).

Storage and stability

Lyophilized product should be stored at 4°C. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity. Under recommended storage conditions, product is stable for one year.

Precautions

For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and Federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result with the use of or derivation of this product.

Disease

Infectious diseases, Nephrology, Neurological disorders

CoA-TDS