Home \ Proteins and peptides \ C5a des Arg, Mouse, Recombinant
C5a des Arg, Mouse, Recombinant-0
Catalog # HC1102-50UG

C5a des Arg, Mouse, Recombinant

Read more

€519.00

Please choose the quantity of items you wish to add to your cart…
Add to basket

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant mouse C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLG.

The molecular weight of the protein is 12 kg/mol.
.

Use
For dilutions use protein stabilized phosphate buffered saline, pH 7.4.

Product type
Proteins
Amount
50 µg
Species
Mouse
Formulation
Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg murine C5a desArg. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Storage and stability
Lyophilized product should be stored at 4°C. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity. Under recommended storage conditions, product is stable for one year.
Precautions
For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and Federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result with the use of or derivation of this product.
Disease
Infectious diseases, Nephrology
CoA-TDS
HC1102
36 kb
Safety Data Sheet
SDS - HC1102-50UG
50 kb

Related products

Calculate your ELISA data easily

With the ELISA calculator you can easily calculate ELISA data. Assayfit Pro helps to perform curve fitting. The calculator generates advanced reports, fit graph, fit parameters and goodness of fit are shown.

Show data entry
Contact us