C5a, Mouse, Recombinant
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a.
Recombinant mouse C5a is His-Tagged and has the following amino acid sequence:
MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYET
CEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLGR. The molecular weight of the protein is 12 kg/mol.
You may also like…
Calculate your ELISA data easily
With the ELISA calculator you can easily calculate ELISA data. Assayfit Pro helps to perform curve fitting. The calculator generates advanced reports, fit graph, fit parameters and goodness of fit are shown.
Latest Hycult Biotech news
- Discover Cross-Reactive Complement ELISA for NHP ResearchBridging Human and NHP Complement Research. At Hycult Biotech, we understand the importance of testing therapeutic agents on non-human primates (NHP) samples in order to get approval to enter clinical phases. That is why we have committed to the following initiative: Testing our existing complement ELISA assays for NHP research. Why Non Human Primate Samples… Read more: Discover Cross-Reactive Complement ELISA for NHP Research
- New Human Complement Pathway AssaysWe are very proud of our newly developed human classical and alternative complement pathway assays. They are produced in response to a growing demand for quantitative investigation of complement inhibitors or regulators at lower sample dilutions. This development aims to address the issue of false negative results, enabling more accurate and reliable analysis of complement… Read more: New Human Complement Pathway Assays
- Navigating the pitfalls in complement analysisOur colleague Erik Toonen shared his experience on how to analyze complement at the Complement-based Drug Development Summit in Boston in September 11-13th, 2023. He showed valuable insights on analyzing complements. For accurate complement analysis, it is important that not only the correct technique is used but also that pre-analytical sample handling is performed in… Read more: Navigating the pitfalls in complement analysis