C5a, Human, Recombinant

Catalog #: HC2101
Quantity: 50 µg

Original supplier of innate immunity products since 1994.

Our commitment to quality: Read more!

Contact our support team for more product information.

Can't find your application for a product? Request a sample!

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant human C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVA


Catalog number HC2101
Product type Proteins
Quantity 50 µg
Species Human
Formulation Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg human C5a. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Storage and stability Lyophilized product should be stored at 4°C. Store stock solution in aliquots at –20°C. Repeated freeze and thaw cycles will cause loss of activity. Under recommended storage conditions, product is stable for one year.
Precautions For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and Federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result with the use of or derivation of this product.
Disease Infectious diseases, Nephrology
  • Application:
    FS, IA, W
  • Use:
    For dilutions use protein stabilized phosphate buffered saline, pH 7.4.
1. Xu, R et al; Complement 5a stimulates hepatic stellate cells in vitro, and is increased in the plasma of patients with chronic hepatitis B. Immunology 2012, 138:228
2. Geering, B et al; DAPK2 positively regulates motility of neutrophils and eosinophils in response to intermediary chemoattractants. J Leuk Biol 2014, 95:293
3. Van den Berg, C et al; Mechanism of Neutrophil Dysfunction: Neutrophil Serine Proteases Cleave and Inactivate the C5a Receptor. J Immunol 2014, 192:1787
4. Hünniger, K et al; A Second Stimulus Required for Enhanced Antifungal Activity of Human Neutrophils in Blood Is Provided by Anaphylatoxin C. J Immunol 2015, 194:1199
5. Maeda, Y et al; C5aR is frequently expressed in metastatic renal cell carcinoma and plays a crucial role in cell invasion via the ERK and PI3 kinase pathways. Oncol Rep 2015, 33:1844