Home \ Proteins and peptides \ Beta-defensin 2, Human, Peptide
Catalog # HC2140-50UG

Beta-defensin 2, Human, Peptide

314,00

Please choose the quantity of items you wish to add to your cart…

Antimicrobial proteins (AMP) are a fundamental element of the primary response against pathogens. AMP’s are small endogenous cationic molecules expressed by phagocytic and epithelial cells. The antimicrobial activity of AMP’s is directed towards a broad spectrum of pathogens, like Gram-positive and -negative bacteria, viruses, yeast and fungi. AMP’s aid in innate immunity and adaptive immunity via direct inactivation and by immunomodulatory activity like leukocyte migration. Defensins are the most prominent mammalian AMP’s. Three defensin peptide families are identified, the α-, β-, and θ-defensins. They are characterized by a triple-stranded β-hairpin structure, six disulfide-linked cysteine residues and a positive charge. They are synthesized as preproteins and undergo processing to become a fully active peptide. Defensins are divided in alpha- and beta-defensins depending on their disulfide bridging pattern. Human beta-defensin-2 (hBD-2) is a cystein-rich cationic 41 amino acid antimicrobial peptide of 4-5 kDa. hBDs are localized in epithelial surfaces. Originally, hBD2 was identified in psoriatic scales. Nowadays, hBD-2 has been described as a dynamic component of the local epithelial defense system of the skin, intestinal and respiratory tract, where it functions by protecting surfaces from infection. The hBD2 gene is flanked by several binding sites of NF-kB. Its expression is inducible by proinflammatory molecules like TNFα, IL1α, diverse panel of bacteria, yeasts, IL22 and most of all by IL-17. hBD2 functions best under low ionic strength conditions and is weakened at high salt concentrations. hBD is capable of forming dimers and its microbial activity derives from the mechanism to permeabilize the anionic lipid bilayer, to form pores and the subsequent release of cellular content. HC2140 is a synthetic peptide and has the following sequence: H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH.

Application
Functional studies, Western blot

Application Notes
W: A reduced sample treatment and SDS-Page was used. The band size is ~12 kDa.
FS: Complement activation after incubation with CVF is tested by the lysis of sheep red blood cells.

Product type
Proteins
Quantity
50 µg
Species
Human
Alias
HBD2
Formulation
Lyophilized
Storage and stability
Product should be stored at -80°C. Store stock solution in aliquots at –80°C. Repeated freeze and thaw cycles will cause loss of activity. Under recommended storage conditions, product is stable for at least one year.
Precautions
For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result from the use or derivation of this product.
CoA-TDS Protein
HC2140
96 kb
HC2140
96 kb

Calculate your ELISA data easily

With the ELISA calculator you can easily calculate ELISA data. Assayfit Pro helps to perform curve fitting. The calculator generates advanced reports, fit graph, fit parameters and goodness of fit are shown.

Hycultbiotech_contact us

Would you like some virtual coffee?

Contact us